Support NeoGAF

[zeemumu]

I got a call back from a job I applied for

Eeeeeeeeeeeeeeeeeeep!!

The cop job, right? Congratulations!

 

[WhereAreMahDragonz]

It's a digital interview. You record yourself answering questions and then send it to them.

This won't be awkward at all.

Edit: not the cop job, another one

 

[The_Poet]

We demand .gifs to me made of it.

 

[TrueGrime]

I got a call back from a job I applied for

Eeeeeeeeeeeeeeeeeeep!!

Nice Emz. Better kill that shit.

 

[NinjaBoiX]

It's a digital interview. You record yourself answering questions and then send it to them.

This won't be awkward at all.

Just pretend it's a Skype call with Tiddums. Stick that boy band face image where he's pulling his top down all sexy like on your screen to ease/accentuate the awkwardness.

 

[zeemumu]

It's a digital interview. You record yourself answering questions and then send it to them.

This won't be awkward at all.

Edit: not the cop job, another one

Better Hide Orlando Bloom

 

[WhereAreMahDragonz]

Just pretend it's a Skype call with Tiddums. Stick that boy band face image where he's pulling his top down all sexy like on your screen to ease/accentuate the awkwardness.

Jckslmslacnwldnalcnspcnlslspanqldnqlxkqlsnskpdnjskdhrksnsosnxoqk

Spoiler

I'll make sure to put Orlando in the background

 

[RobotNinjaHornets]

If you want the advice I gave my friend, it was "just remember to put the pussy on the chainwax"

I don't think I was very useful

 

[You Know Nothing]

Ugh, stomach hurts. I am a good person. Why is God punishing me?

It's a digital interview. You record yourself answering questions and then send it to them.

This won't be awkward at all.

Edit: not the cop job, another one

Check yo PMs. :eyes:

 

[WhereAreMahDragonz]

"Please hire me"

 

[The_Poet]

Write it on your forehead. Shows enthusiasm and initiative.

 

[NinjaBoiX]

Write it on your forehead.

PJ Harvey - Written On The Forehead

Anyone in need of a pick me up, listen to this jam. It's positively life affirming.

 

[zeemumu]

I hope that when the day comes for me to get a full time job, it's something that I legitimately enjoy doing. I couldn't imagine working retail full time. I can barely handle part time. I don't want retail to be the death of me. I Thought I'd die Keeping Something Busy While A Self Destruct Sequence goes off, then make some small indication that I'm still alive, but I'm starting my life over in a new location...or maybe just that last sentence.

 

[Wazzy]

Looks like it's goodbye for Japan. ; ;

 

[MutFox]

Sayonara...

 

[You Know Nothing]

"Please hire me"

Why so grumpy, sis?

Smile!

Spoiler

My hair is a mess. Why did I post this? I look like legit trash.

 

[RobotNinjaHornets]

Why so grumpy, sis?

Smile!

Spoiler

My hair is a mess. Why did I post this? I look like legit trash.

I totally thought the windows were earrings for a second there

 

[You Know Nothing]

Fuck it. I'm just gonna go shave it all off. I am not here for this.

I totally thought the windows were earrings for a second there

Oh god. Cannot unsee.

 

[RobotNinjaHornets]

I don't understand the Kermit thread

It makes no sense

Where jokes? Where comedy?

 

[zeemumu]

I don't understand the Kermit thread

It makes no sense

Where jokes? Where comedy?

It's Kermit being passive aggressive. A lot of the posts in there aren't exactly passive aggressive, but it's none of my business, though.

 

[G-Fex]

I look a lot worse right now don't worry.

I need to shave, usually bleeding a quart of blood with each shave #Nicks

 

[MutFox]

Zombie eat flesh...

 

[RobotNinjaHornets]

It's Kermit being passive aggressive. A lot of the posts in there aren't exactly passive aggressive, but it's none of my business, though.

But comedy! I don't get where the humour is D:

 

[ThoseDeafMutes]

I got a call back from a job I applied for

Eeeeeeeeeeeeeeeeeeep!!

Congrats!

 

[Wazzy]

Congratz on the call back Em!

You got dis.

 

[You Know Nothing]

A nice light rain rn.

Man, running's gonna be nice.

Spoiler

I mean that too. Not sarcasm.

 

[George Oscar Bluth II]

I don't understand the Kermit thread

It makes no sense

Where jokes? Where comedy?

You and me both, pal.

 

[smokeandmirrors]

man what ever happened to orlando bloom

 

[Lucian Cat]

A nice light rain rn.

Man, running's gonna be nice.

Spoiler

I mean that too. Not sarcasm.

Haven't gone running in a week. Been raining too hard. I feel fat

 

[Professor Beef]

Grats on the job, Dragonz!

 

[You Know Nothing]

The light rain turned into a downpour.

LET'S GET A LITTLE WET
I LIKE THE WAY YOU'RE WORKIN' ME OUT

Spoiler

I didn't hate it. Except for my jacket feeling like a second skin.

 

[WhereAreMahDragonz]

man what ever happened to orlando bloom

He has taken up permanent residence in my bedroom

Also thank you everyone

 

[TrueGrime]

Zombie eat flesh...

LOL.

https://twitter.com/holyfield/status/481507319595823104

 

[You Know Nothing]

He has taken up permanent residence in my bedroom

You couldn't get someone hotter tho?

Spoiler

I want a Theo James poster tbh.

 

[Wazzy]

Cool I can get GTA 5 for $20 exactly. Gonna get it Friday.

 

[G-Fex]

I got a call back from a job I applied for

Eeeeeeeeeeeeeeeeeeep!!

sorry i'm late for this but congrats.

I...I really hope I get called back ;-;

 

[WhereAreMahDragonz]

You couldn't get someone hotter tho?

Spoiler

I want a Theo James poster tbh.

Speaking of, they released a Peeta poster the other day

Apparently we're getting a trailer Thursday

 

[You Know Nothing]

Speaking of, they released a Peeta poster the other day

Apparently we're getting a trailer Thursday

Whoo!

 

[Turin]

Why so grumpy, sis?

Smile!

Spoiler

My hair is a mess. Why did I post this? I look like legit trash.

At least you don't look like a psycho. (I was playing with the ipad)

 

[zeemumu]

Haven't gone running in a week. Been raining too hard. I feel fat

I bought Just Dance for the days when I don't feel like running.

 

[Windam]

Turn your head and see the fields of flames

(Don't move along)
He carries along
('Cause things they will go wrong)

From a distant place
(The end is getting closer)
He's on his way
(Day by day)

He'll bring decay
In shades of gray
We're doomed to face the night
Light's out of sight

Since we've reached the point of no return
We pray for the starlight we wait for the moon
The sky is empty, alone in the unknown
We're getting nowhere

We have been betrayed by the wind and the rain
The sacred hall's empty and cold
The sacrifice made should not be done in vain
Revenge will be taken by Rome

We live a lie
Under the dying moon
Pale-faced laughs doom
Indulges in delight

It's getting out of hand
The final curtain will fall

Hear my voice
There is no choice
There's no way out
You'll find out

We don't regret it
So many men have failed but now he's
(Gone)
Go out and get it

The madman's head it shall be thine
We don't regret it
That someone else dies hidden in
(Disguise)

Go out and get it
Orion's hound shines bright

Don't you think it's time to stop the chase
Around the ring
Just stop running, running
Round the ring

Don't you know that fate
Has been decided by the gods?
Feel the distance, distance
Out of reach

Welcome to the end
Watch your step, Cassandra, you may fall
As I've stumbled on the field
Find myself in darkest places
(Sister mine)

Find myself drifting away
(Death's a certain thing)
And the other world
The other world appears

Find myself she dies in vain

I cannot be freed, I'm falling down
As time runs faster, moves towards disaster
The ferryman will wait for you, my dear

And then there was silence
Just a voice from the other world
Like a leaf in an icy world
Memories will fade

Misty tales and poems lost
All the bliss and beauty
Will be gone, will my weary soul find
Release for a while
At the moment of death I will smile
It's the triumph of shame and disease

In the end
(Iliad)
Raise my hands and praise the day
Break the spell show me the
(Way)
In decay, the flame of Troy will shine bright

The newborn child will carry ruin to the hall
The newborn's death
Would be a blessing to us all

Good choice? Bad choice?
Out of three you've chosen misery

Power and wisdom you deny
(Bad choice, bad choice)

War is the only answer
When love will conquer fear

So the judgment's been made
To the fairest the graceful says
Badly he fails

(Warning)
Fear the heat of passion, father king
(Don't let him in, don't let her in)
Desire, lust, obsession
Death they'll bring
(We can't get out once they are in)

She's like the sunrise
Outshines the moon at night
Precious like starlight
She will bring in a murderous price

(In darkness grows the seed of man's defeat)
Jealousy
(I can clearly see the end now)
I can clearly see the end now
I can clearly see the end now

(The thread of life is spun)
The coin's been placed below my tongue

Never give up, never give in
Be on our side so we can win
Never give up, never give in
Be on our side

(Old moon's time)
Is soon to come

Nowhere to run, nowhere to hide
Nothing to lose like one we'll stand
We'll face the storm
Created by a man

Roar, roar, roar, roar
Troy
(Troy, Troy, Troy)
And as the lion slaughters man
I am the wolf and you're the lamb

(Hallowed)
Troy will fall round the walls
Faith is shattered, bodies fall

Nowhere to run, nowhere to hide
Nothing to lose like one we'll stand
It's all for one and one for all
We live for will be wiped out

I feel that something's
(Wrong)
Surprise, surprise they're gone

Full moon your time goes by
And new moon's still kept out of sight
We live, misty tales and poems lost
(We die)
All the bliss and beauty will be gone

Will my weary soul find release for a while
At the moment of death I will smile
It's the triumph of shame and disease

In the end
(Iliad)
Raise my hands and praise the day
Break the spell show me the
(Way)
In decay, the flame of Troy will shine bright

Roam in darkness
(Spread the vision)
Roam in darkness
(Spread the vision)

Roam in darkness
(Spread the vision)
Roam in darkness
(Spread the vision)

(Roam in darkness)
(We will be lost if you truly believe)
(Roam in darkness)
Troy in darkness

(There's a cold emptiness in our hearts)
That they've gone away
(And)
Won't come back

They'll tear down the wall to bring it in
They'll truly believe in the lie
Lie, lie

With blossoms
They'll welcome the old foe

The vision's so clear
When day and dream
Unite the end is near
You better be prepared

The nightmare shall be over now
There's nothing more to fear
Come join in our singing
And dance with us now

The nightmare shall be over now
There's nothing more to fear
The war it is over forevermore

No hope
The blind leads the blind
Carry on
Though future's denied

Mare or stallion
There's far more inside
We are in at the kill
We'll cheerfully die

Misty tales and poems lost
All the bliss and beauty
Will be gone
(Will)
My weary soul find release for a while
At the moment of death I will smile
It's the triumph of shame and disease

In the end
(Iliad)
Raise my hands and praise the day
Break the spell show me the
(Way)
In decay, the flame of Troy will shine bright

Holy light shines on

So the judgment's been made
We're condemned
Though the trial's far ahead

The crack of doom, Father
Your handsome son is heading home

Still the wind blows, calm and silent
Carries news from a distant shore
Still the wind blows, calm and silent
Carries news from a distant shore
Still the wind blows, calm and silent
(Out of mind)

Carries news from a distant shore
(Can't get it)
(Still the wind blows, calm and silent)
(Out of mind)

(Carries news from a distant shore)
(Can't get it out of my head)
(Can't get it out of mind)
(Can't get it out of my head)

Sorrow and defeat
Sorrow and defeat

 

[Turin]

Music video of the song Euphoria by Collide that sir AcridMeat posted. Really cool imagery. How have I not heard of them till now?! o.o

They have a shit ton of material and I just recently quit downloading off torrents(too risky). Goddammit!

Haven't gone running in a week. Been raining too hard. I feel fat

I bought Just Dance for the days when I don't feel like running.

Buy a heavy bag and a round timer. That shit works very well when you get used to it.

 

[You Know Nothing]

At least you don't look like a psycho. (I was playing with the ipad)

lol

I cut my hair and shaved. I feel #bootyfull again.

 

[Windam]

poor eyebrows 1.98/10 would not bang

 

[zeemumu]

Lt. Dan told Forrest Gump that the day that he became a shimp boat captain was the day that Lt. Dan would become an astronaut. Both actors did Apollo 13 as their next film. That's fricken hilarious.

 

[G-Fex]

you can't use decimal system, this isn't IGN

 

[Windam]

fuck off i can do whatever i want your post gets a 0.6589457592472942729/10

 

[G-Fex]

you get -F

-F -F -F -F

 

[You Know Nothing]

poor eyebrows 1.98/10 would not bang

Ch...

We can't all have chola manicured brows, bew.

 

[Toa TAK]

Damn, even in the Library I cannot be left alone. And it's okay to talk loudly on the phone.